Iright
BRAND / VENDOR: Proteintech

Proteintech, 25348-1-AP, RSPO1 Polyclonal antibody

CATALOG NUMBER: 25348-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RSPO1 (25348-1-AP) by Proteintech is a Polyclonal antibody targeting RSPO1 in WB, IHC, ELISA applications with reactivity to human, rat samples 25348-1-AP targets RSPO1 in WB, IF, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: human plasma, rat plasma Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information RSPO1, also named R-spondin-1, Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Has a essential role in ovary determination. Regulates Wnt signaling by antagonizing DKK1/KREM1-mediated internalization of LRP6 through an interaction with KREM1. RSPO1 seems to mainly localize to nucleoli (PMID:17804805). Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21858 Product name: Recombinant human RSPO1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-263 aa of BC114966 Sequence: MRLGLCVVALVLSWTHLTISSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA Predict reactive species Full Name: R-spondin homolog (Xenopus laevis) Calculated Molecular Weight: 263 aa, 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC114966 Gene Symbol: RSPO1 Gene ID (NCBI): 284654 RRID: AB_2880038 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q2MKA7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924