Iright
BRAND / VENDOR: Proteintech

Proteintech, 25350-1-AP, NOX5 Polyclonal antibody

CATALOG NUMBER: 25350-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NOX5 (25350-1-AP) by Proteintech is a Polyclonal antibody targeting NOX5 in WB, IHC, ELISA applications with reactivity to human samples 25350-1-AP targets NOX5 in WB, IHC, CoIP, ELISA, PLA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, Raji cells Positive IHC detected in: human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NOX5 (NADPH oxidase, EF-hand calcium binding domain 5) is an NADPH oxidase that generates superoxide and functions as an H+ channel in a Ca(2+)-dependent manner. It plays an important role in PDGF-induced JAK/STAT activation and human aortic smooth muscle cell (HASMC) proliferation. NOX5 is the main source of superoxide and is implicated in human spermatozoa motility. This protein has 6 isoforms produced by alternative splicing, named NOX5-α, -β, -γ, -δ, -ε and -ζ with the molecular mass of 84, 82, 86, 85, 64 and 83 kDa (PMID: 22427510 and Uniprot). Specification Tested Reactivity: human Cited Reactivity: human, pig, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18673 Product name: Recombinant human NOX5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 559-719 aa of BC125098 Sequence: YRHQKRKHTCPSCQHSWIEGVQDNMKLHKVDFIWINRDQRSFEWFVSLLTKLEMDQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITGLQTRTQPGRPDWSKVFQKVAAEKKGKVQVFFCGSPALAKVLKGHCEKFGFRFFQENF Predict reactive species Full Name: NADPH oxidase, EF-hand calcium binding domain 5 Calculated Molecular Weight: 765 aa, 86 kDa Observed Molecular Weight: 82-86 kDa GenBank Accession Number: BC125098 Gene Symbol: NOX5 Gene ID (NCBI): 79400 RRID: AB_2811208 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96PH1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924