Proteintech, 25352-1-AP, TTC30A Polyclonal antibody

Size: 20ul / 150ul The TTC30A (25352-1-AP) by Proteintech is a Polyclonal antibody targeting TTC30A in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 25352-1-AP targets TTC30A in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, HEK-293 cells, mouse testis, rat testis Positive IP detected in: HEK-293 cells Positive IF/ICC detected in: hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18361 Product name: Recombinant human TTC30A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-342 aa of BC042848 Sequence: MAGLSGAQIPDGEFTALVYRLIRDARYAEAVQLLGRELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYPEATRVAFLLLDNPAYHSRVLRLQAAIKYSEGDLPGSRSLVEQLLSGEGGEESGGDNETDGQVNLGCLLYKEGQYEAACSKFSATLQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGFDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEVAQETLTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADV Predict reactive species Full Name: tetratricopeptide repeat domain 30A Calculated Molecular Weight: 665 aa, 76 kDa Observed Molecular Weight: 72-76 kDa GenBank Accession Number: BC042848 Gene Symbol: TTC30A Gene ID (NCBI): 92104 RRID: AB_2651172 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86WT1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.