Iright
BRAND / VENDOR: Proteintech

Proteintech, 25373-1-AP, Exportin 4 Polyclonal antibody

CATALOG NUMBER: 25373-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Exportin 4 (25373-1-AP) by Proteintech is a Polyclonal antibody targeting Exportin 4 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25373-1-AP targets Exportin 4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HL-60 cells, HeLa cells, RAW 264.7 cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information exportin 4 (XPO4) maps to chromosome 13q and belongs to the importin β family which acts as a bidirectional nuclear transport receptor. Decreased XPO4 expression has been shown to associate with hepatocellular carcinoma. A genome-wide copy number variation (CNV) association study in a small cohort of Malaysian subjects identified a CNV in XPO4 to be correlated with the progression of metabolic (dysfunction) associated fatty liver disease (MAFLD). (PMID: 34388518) Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21845 Product name: Recombinant human XPO4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 776-1124 aa of BC113571 Sequence: QEITATLEALCGIAEATQIDNVAILFNFLMDFLTNCIGLMEVYKNTPETVNLIIEVFVEVAHKQICYLGESKAMNLYEACLTLLQVYSKNNLGRQRIDVTAEEEQYQDLLLIMELLTNLLSKEFIDFSDTDEVFRGHEPGQAANRSVSAADVVLYGVNLILPLMSQDLLKFPTLCNQYYKLITFICEIFPEKIPQLPEDLFKSLMYSLELGMTSMSSEVCQLCLEALTPLAEQCAKAQETDSPLFLATRHFLKLVFDMLVLQKHNTEMTTAAGEAFYTLVCLHQAEYSELVETLLSSQQDPVIYQRLADAFNKLTASSTPPTLDRKQKMAFLKSLEEFMANVGGLLCVK Predict reactive species Full Name: exportin 4 Calculated Molecular Weight: 1151 aa, 130 kDa Observed Molecular Weight: 127 kDa GenBank Accession Number: BC113571 Gene Symbol: Exportin 4/XPO4 Gene ID (NCBI): 64328 RRID: AB_3085791 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9C0E2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924