Iright
BRAND / VENDOR: Proteintech

Proteintech, 25377-1-AP, DDI2 Polyclonal antibody

CATALOG NUMBER: 25377-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DDI2 (25377-1-AP) by Proteintech is a Polyclonal antibody targeting DDI2 in WB, IF/ICC, ELISA applications with reactivity to human samples 25377-1-AP targets DDI2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HL-60 tissue, HUVEC tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DDI2 contains 399 amino acids and contains an N-terminal ubiquitin-like (UBL) domain and a highly conserved retroviral protease-like (RVP) domain. DDI2 is an aspartic endoprotease that cleaves ubiquitylated target proteins to assist in their processing by the ubiquitin-proteasome system (UPS), especially when the UPS is inhibited(PMID: 32521225). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21953 Product name: Recombinant human DDI2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 22-62 aa of BC006011 Sequence: DADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLA Predict reactive species Full Name: DDI1, DNA-damage inducible 1, homolog 2 (S. cerevisiae) Calculated Molecular Weight: 399 aa, 45 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC006011 Gene Symbol: DDI2 Gene ID (NCBI): 84301 RRID: AB_3669472 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5TDH0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924