Proteintech, 25399-1-AP, FOXN3 Polyclonal antibody

Size: 20ul / 150ul The FOXN3 (25399-1-AP) by Proteintech is a Polyclonal antibody targeting FOXN3 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 25399-1-AP targets FOXN3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, mouse embryo tissue Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information As transcriptional regulators, the FOX protein family regulates the development of tissues, embryos as well as carbohydrate and lipid metabolism. Forkhead box N3 (FOXN3), also known as checkpoint suppressor 1 (CHES1), is initially identified from yeast and belongs to the FOX protein family as it contains a conserved FOX DNA binding domain in its N-terminal(PMID: 36450706). FOXN3 had been dysregulated in many types of malignancies including melanoma, osteosarcoma, hepatocellular carcinoma and breast cancer, and its expression level is strongly associated with progression and prognosis of patients(PMID: 31214487). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21929 Product name: Recombinant human FOXN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC007506 Sequence: MGPVMPPSKKPESSGISVSSGLSQCYGGSGFSKALQEDDDLDFSLPDIRLEEGAMEDEEL Predict reactive species Full Name: forkhead box N3 Calculated Molecular Weight: 490 aa, 54 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC007506 Gene Symbol: FOXN3 Gene ID (NCBI): 1112 RRID: AB_3085795 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00409 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.