Proteintech, 25415-1-AP, SOX15 Polyclonal antibody

Size: 20ul / 150ul The SOX15 (25415-1-AP) by Proteintech is a Polyclonal antibody targeting SOX15 in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 25415-1-AP targets SOX15 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse embryo tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse embryo tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information SOX15, also named as SOX12, SOX20, is a 223 amino acid protein, which contains one HMG box DNA-binding domain. SOX15 is widely expressed in fetal and adult tissues and highest level is found in fetal spinal cord and adult brain and testis. SOX15 is a candidate tumor suppressor in pancreatic cancer with a potential role in Wnt/β-catenin signaling. Sox15 is required for skeletal muscle regeneration and is up regulated in the embryonic mouse testis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22032 Product name: Recombinant human SOX15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 124-233 aa of BC000985 Sequence: AKSSGAGPSRCGQGRGNLASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEAPSPCSLPQSDPRLQGELLPTYTHYLPPGSPTPYNPPLAGAPMPLTHL Predict reactive species Full Name: SRY (sex determining region Y)-box 15 Calculated Molecular Weight: 25 kDa GenBank Accession Number: BC000985 Gene Symbol: SOX15 Gene ID (NCBI): 6665 RRID: AB_2880067 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60248 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.