Iright
BRAND / VENDOR: Proteintech

Proteintech, 25418-1-AP, TSC22D2 Polyclonal antibody

CATALOG NUMBER: 25418-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TSC22D2 (25418-1-AP) by Proteintech is a Polyclonal antibody targeting TSC22D2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 25418-1-AP targets TSC22D2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, MDA-MB-453s cells, HepG2 cells, SH-SY5Y cells Positive IP detected in: HepG2 cells Positive IHC detected in: human kidney tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information TSC22D2 (transforming growth factor β-stimulated clone 22 domain family, member 2) is a member of the TSC-22 domain family comprising putative transcription factors that are characterized by a carboxy-terminal leucine zipper and an adjacent TSC-box. TSC22D2 is expressed at low levels in CRC and that TSC22D2 overexpression significantly inhibited the growth rate of cancer cells (PMID: 27573352). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22294 Product name: Recombinant human TSC22D2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 190-543 aa of BC044643 Sequence: SDSSVLTRSGDCIRHSSTFDQTAERDSGLGATGGSVVVVVASMQGAHGPESGTDSSLTAVSQLPPSEKMSQPTPAQPQSFSVGQPQPPPPPVGGAVAQSSAPLPPFPGAATGPQPMMAAAQPSQPQGAGPGGQTLPPTNVTLAQPAMSLPPQPGPAVGAPAAQQPQQFAYPQPQIPPGHLLPVQPSGQSEYLQQHVAGLQPPSPAQPSSTGAAASPATAATLPVGTGQNASSVGAQLMGASSQPSEAMAPRTGPAQGGQVAPCQPTGVPPATVGGVVQPCLGPAGAGQPQSVPPPQMGGSGPLSAVPGGPHAVVPGVPNVPAAVPAPSVPSVSTTSVTMPNVPAPLAQSQQLSS Predict reactive species Full Name: TSC22 domain family, member 2 Calculated Molecular Weight: 780 aa, 79 kDa Observed Molecular Weight: 100-110 kDa GenBank Accession Number: BC044643 Gene Symbol: TSC22D2 Gene ID (NCBI): 9819 RRID: AB_2880069 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75157 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924