Iright
BRAND / VENDOR: Proteintech

Proteintech, 25431-1-AP, NBEAL1 Polyclonal antibody

CATALOG NUMBER: 25431-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NBEAL1 (25431-1-AP) by Proteintech is a Polyclonal antibody targeting NBEAL1 in WB, ELISA applications with reactivity to human samples 25431-1-AP targets NBEAL1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Neurobeachin-like 1 (NBEAL1) is a Golgi-associated protein that plays an essential role in cholesterol metabolism regulation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22125 Product name: Recombinant human NBEAL1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-200 aa of BC137214 Sequence: MASRERLFELWMLYCTKKDPDYLKLWLDTFVSSYEQFLDVDFEKLPTRVDDMPPGISLLPDNILQVLRIQLLQCVQKMADGLEEQQQALSILLVKFFIILCRNLSNVEEIGTCSYINYVITMTTLYIQQLKSKKKEKEMADQTCIEEFVIHALAFCESLYDPYRNWRHRISGSQIPEGFLRHISIRVSSGKNPATPTPEG Predict reactive species Full Name: neurobeachin-like 1 Calculated Molecular Weight: 200 aa, 307 kDa Observed Molecular Weight: 280 kDa GenBank Accession Number: BC137214 Gene Symbol: NBEAL1 Gene ID (NCBI): 65065 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZS30 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924