Proteintech, 25432-1-AP, BIVM Polyclonal antibody

Size: 20ul / 150ul The BIVM (25432-1-AP) by Proteintech is a Polyclonal antibody targeting BIVM in WB, IHC, ELISA applications with reactivity to human samples 25432-1-AP targets BIVM in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells Positive IHC detected in: human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information BIVM has been identified using an electronic search based on the conservation of short sequence motifs within the variable region of immunoglobulin (Ig) genes. It is tightly linked (41 bp) and in the opposite transcriptional orientation to MGC5302 (also known as KDEL1 and EP58) in human. BIVM has two isoforms with MW 57 kDa and 32 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22087 Product name: Recombinant human BIVM protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 411-503 aa of BC075084 Sequence: LHCIIAFQRLNWQRFGLWNFPFGTIRQESQPPTHAQGIAKSESEDNISKKQHGRLGRSFSASFHQDSAWKKMSSIHERRNSGYQGYSDYDGND Predict reactive species Full Name: basic, immunoglobulin-like variable motif containing Calculated Molecular Weight: 503 aa, 57 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC075084 Gene Symbol: BIVM Gene ID (NCBI): 54841 RRID: AB_2880076 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86UB2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.