Iright
BRAND / VENDOR: Proteintech

Proteintech, 25438-1-AP, BFSP2 Polyclonal antibody

CATALOG NUMBER: 25438-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BFSP2 (25438-1-AP) by Proteintech is a Polyclonal antibody targeting BFSP2 in WB, ELISA applications with reactivity to human, mouse, rat samples 25438-1-AP targets BFSP2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse eye tissue, rat eye tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22073 Product name: Recombinant human BFSP2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-225 aa of BC113518 Sequence: MSERRVVVDLPTSASSSMPLQRRRASFRGPRSSSSLESPPASRTNAMSGLVRAPGVYVGTAPSGCIGGLGARVTRRALGISSVFLQGLRSSGLATVPAPGLERDHGAVEDLGGCLVEYMAKVHALEQVSQELETQLRMHLESKATRSGNWGALRASWASSCQQVGEAVLENARLMLQTETIQAGADDFKERYENEQPFRKAAEEEINSLYKVIDEANLTKMDLES Predict reactive species Full Name: beaded filament structural protein 2, phakinin Calculated Molecular Weight: 415 aa, 46 kDa Observed Molecular Weight: 45-49 kDa GenBank Accession Number: BC113518 Gene Symbol: BFSP2 Gene ID (NCBI): 8419 RRID: AB_2880080 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13515 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924