Proteintech, 25439-1-AP, SCML4 Polyclonal antibody

Size: 20ul / 150ul The SCML4 (25439-1-AP) by Proteintech is a Polyclonal antibody targeting SCML4 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25439-1-AP targets SCML4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, A375 cells, HEK-293 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22157 Product name: Recombinant human SCML4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 161-305 aa of BC033286 Sequence: AKLCRSLLCDDLFSHQPFPRGCSASEKVQEKEEGRMESVKTVTTEEYLVNPVGMNRYSVDTSASTFNHRGSLHPSSSLYCKRQNSGDSHLGGGPAATAGGPRTSPMSSGGPSAPGLRPPASSPKRNTTSLEGNRCGNVMHASASH Predict reactive species Full Name: sex comb on midleg-like 4 (Drosophila) Calculated Molecular Weight: 414 aa, 45 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC033286 Gene Symbol: SCML4 Gene ID (NCBI): 256380 RRID: AB_2880081 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N228 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.