Iright
BRAND / VENDOR: Proteintech

Proteintech, 25444-1-AP, DNAJC9 Polyclonal antibody

CATALOG NUMBER: 25444-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DNAJC9 (25444-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJC9 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 25444-1-AP targets DNAJC9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, SH-SY5Y cells, Raji cells, HeLa cells Positive IHC detected in: human breast cancer tissue, human colon cancer tissue, mouse colon tissue, rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DNAJC9, DnaJ homolog subfamily C member 9, acts as a dual histone chaperone and heat shock co-chaperone (PMID: 33857403). As a histone chaperone, DNAJC9 forms a co-chaperone complex with MCM2 and histone H3-H4 heterodimers (PMID: 33857403). DNAJC9 also plays a role as co-chaperone of the HSP70 family of molecular chaperone proteins. (PMID: 17182002, PMID: 33857403). DNAJC9 exhibits activity to assemble histones onto DNA (PMID: 33857403). DNAJC9 is an essential protein in many cancer cell types and the levels of the protein correlate with the rates at which cancer cells proliferate. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22123 Product name: Recombinant human DNAJC9 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-260 aa of BC136507 Sequence: MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKK Predict reactive species Full Name: DnaJ (Hsp40) homolog, subfamily C, member 9 Calculated Molecular Weight: 260 aa, 30 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC136507 Gene Symbol: DNAJC9 Gene ID (NCBI): 23234 RRID: AB_2880084 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WXX5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924