Iright
BRAND / VENDOR: Proteintech

Proteintech, 25447-1-AP, C15orf58 Polyclonal antibody

CATALOG NUMBER: 25447-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C15orf58 (25447-1-AP) by Proteintech is a Polyclonal antibody targeting C15orf58 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 25447-1-AP targets C15orf58 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: PC-3 cells, mouse brain tissue Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20215 Product name: Recombinant human C15orf58 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-170 aa of BC127821 Sequence: MALPHDSNETSYLLPPNNEDWGGQTIPDFVYGQKDLTAEGIQWPRNAPGIPDALPQSPFDAALCSAWKQRVELGLFRYRLRELQTQILPGAVGFVAQLNVERGVQRRPPQTIKSVRQAFDPVQFNFNKIRPGEVLFRLHREPDLPGTLLQEDILVVINVSPLEWGHISEI Predict reactive species Full Name: chromosome 15 open reading frame 58 Calculated Molecular Weight: 385 aa, 42 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC127821 Gene Symbol: C15orf58 Gene ID (NCBI): 390637 RRID: AB_2880085 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZNW5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924