Iright
BRAND / VENDOR: Proteintech

Proteintech, 25455-1-AP, ZBTB46 Polyclonal antibody

CATALOG NUMBER: 25455-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZBTB46 (25455-1-AP) by Proteintech is a Polyclonal antibody targeting ZBTB46 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25455-1-AP targets ZBTB46 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: RAW 264.7 cells Positive IHC detected in: mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ZBTB46, also named as BTBD4, ZNF340, is a 589 amino acid protein, which contains one BTB (POZ) domain and two C2H2-type zinc fingers. ZBTB46 functions as a transcriptional repressor for PRDM1. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22273 Product name: Recombinant human ZBTB46 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 140-416 aa of BC073800 Sequence: ELAEFEIGASSSSSTEALISAVMAGRSISPWLARRTSPANSSGDSAIASCHDGGSSYGKEDQEPKADGPDDVSSQPLWPGDVGYGPLRIKEEQVSPSQYGGSELPSAKDGAVQNSFSEQSAGDAWQPTGRRKNRKNKETVRHITQQVEDDSRASSPVPSFLPTSGWPFSSRDSNADLSVTEASSSDSRGERAELYAQVEEGLLGGEASYLGPPLTPEKDDALHQATAVANLRAALMSKNSLLSLKADVLGDDGSLLFEYLPRGAHSLSLNEFTVIRK Predict reactive species Full Name: zinc finger and BTB domain containing 46 Calculated Molecular Weight: 589 aa, 64 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC073800 Gene Symbol: ZBTB46 Gene ID (NCBI): 140685 RRID: AB_2880088 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86UZ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924