Proteintech, 25464-1-AP, C2orf51 Polyclonal antibody

Size: 20ul / 150ul The C2orf51 (25464-1-AP) by Proteintech is a Polyclonal antibody targeting C2orf51 in WB, ELISA applications with reactivity to human, mouse samples 25464-1-AP targets C2orf51 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information C2orf51, also named as TEX37 and TSC21, is a protein with calculated MW 21 kDa. We always detect 35 kDa in our WB detection. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21923 Product name: Recombinant human C2orf51 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-180 aa of BC029522 Sequence: MAGVKYPGQDPVDLDIYQSSHMVDYQPYRKHKYSRVTPQEQAKLDAQLRDKEFYRPIPNPNPKLTDGYPAFKRPHMTAKDLGLPGFFPSQEHEATREDERKFTSTCHFTYPASHDLHLAQGDPNQVLQSADFPCLVDPKHQPAAEMAKGYLLLPGCPCLHCHIVKVPILNRWGPLMPFYQ Predict reactive species Full Name: chromosome 2 open reading frame 51 Calculated Molecular Weight: 180 aa, 21 kDa Observed Molecular Weight: ~35 kDa GenBank Accession Number: BC029522 Gene Symbol: C2orf51 Gene ID (NCBI): 200523 RRID: AB_2880092 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96LM6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.