Iright
BRAND / VENDOR: Proteintech

Proteintech, 25469-1-AP, PNPLA4 Polyclonal antibody

CATALOG NUMBER: 25469-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PNPLA4 (25469-1-AP) by Proteintech is a Polyclonal antibody targeting PNPLA4 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 25469-1-AP targets PNPLA4 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PNPLA4(Patatin-like phospholipase domain-containing protein 4) is also named as DXS1283E, GS2. It participate in triacylglycerol hydrolysis and the acyl-CoA independent transacylation of acylglycerols, there by facilitating energy mobilization and storage in adipocytes. This protein has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22091 Product name: Recombinant human PNPLA4 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-253 aa of BC020746 Sequence: MKHINLSFAACGFLGIYHLGAASALCRHGKKLVKDVKAFAGASAGSLGASVLLTAPEKIEECNQFTYKFAEEIRRQSFGAVTPGYDFMARLRSGMESILPPSAHELAQNRLHVSITNAKTRENHLVSTFSSREGLIKVLLASSFVPIYAGLKLVEYKGQKWVDGGLTNALPILPVGRTVTISPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKMESLYQCGFDDTVKFLLKENWFE Predict reactive species Full Name: patatin-like phospholipase domain containing 4 Calculated Molecular Weight: 253 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC020746 Gene Symbol: PNPLA4 Gene ID (NCBI): 8228 RRID: AB_2880095 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P41247 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924