Iright
BRAND / VENDOR: Proteintech

Proteintech, 25503-1-AP, UCMA Polyclonal antibody

CATALOG NUMBER: 25503-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UCMA (25503-1-AP) by Proteintech is a Polyclonal antibody targeting UCMA in WB, ELISA applications with reactivity to human, mouse samples 25503-1-AP targets UCMA in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information UCMA, also named as C10orf49, Ucma-C and GRP, is a 17 kDa small, highly charged, and secreted protein. It has been described as a novel secretory protein mainly expressed in cartilage and also as a novel vitamin-K-dependent protein. UCMA is involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells in peripheral zones of fetal cartilage and at the cartilage-bone interface. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21985 Product name: Recombinant human UCMA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-139 aa of BC018068 Sequence: VSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT Predict reactive species Full Name: upper zone of growth plate and cartilage matrix associated Calculated Molecular Weight: 138 aa, 17 kDa Observed Molecular Weight: ~14 kDa GenBank Accession Number: BC018068 Gene Symbol: UCMA Gene ID (NCBI): 221044 RRID: AB_2880106 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WVF2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924