Iright
BRAND / VENDOR: Proteintech

Proteintech, 25512-1-AP, PDZD8 Polyclonal antibody

CATALOG NUMBER: 25512-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PDZD8 (25512-1-AP) by Proteintech is a Polyclonal antibody targeting PDZD8 in WB, ELISA applications with reactivity to human samples 25512-1-AP targets PDZD8 in WB, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, HEK-293 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information PDZD8 (PDZ domain containing 8) is an SMP (synaptotagmin-like mitochondrial-lipid-binding) domain-containing protein belonging to the tubular lipid-binding protein (TULIP) superfamily of lipid transfer proteins (PMID: 37961523). PDZD8 is an integral ER transmembrane protein present at ER-mitochondria contacts (PMID: 29097544). It is involved in regulating ER-mitochondria associations, mitochondrial calcium ion homeostasis, and lipid transport between the ER and late endosomes/lysosomes (PMID: 37247681; 29097544; 33912962). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21914 Product name: Recombinant human PDZD8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 803-1154 aa of BC028375 Sequence: HHVVTNVEKEKEPHLVEEVSVLPKEEQFVGQMGLTENKHSFQDTQFQNPTWCDYCKKKVWTKAASQCMFCAYVCHKKCQEKCLAETSVCGATDRRIDRTLKNLRLEGQETLLGLPPRVDAEASKSVNKTTGLTRHIINTSSRLLNLRQVSKTRLSEPGTDLVEPSPKHTPNTSDNEGSDTEVCGPNSPSKRGNSTGIKLVRKEGGLDDSVFIAVKEIGRDLYRGLPTEERIQKLEFMLDKLQNEIDQELEHNNSLVREEKETTDTRKKSLLSAALAKSGERLQALTLLMIHYRAGIEDIETLESLSLDQHSKKISKYTDDTEEDLDNEISQLIDSQPFSSISDDLFGPSESV Predict reactive species Full Name: PDZ domain containing 8 Calculated Molecular Weight: 1154 aa, 129 kDa Observed Molecular Weight: 150-160 kDa GenBank Accession Number: BC028375 Gene Symbol: PDZD8 Gene ID (NCBI): 118987 RRID: AB_2880110 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NEN9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924