Proteintech, 25524-1-AP, APP/Beta Amyloid Polyclonal antibody

Size: 20ul / 150ul The APP/Beta Amyloid (25524-1-AP) by Proteintech is a Polyclonal antibody targeting APP/Beta Amyloid in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 25524-1-AP targets APP/Beta Amyloid in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, HAP1 cells, HeLa cells, NCI-H1299 cells, mouse brain tissue, rat brain tissue, C6 cells Positive IHC detected in: human gliomas tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Aβ derives from APP via proteolytic cleavage by proteases called α-, β- and γ-secretase. The α-secretase cleavage precludes the formation of Aβ, while the β- and γ-cleavages generate APP components with amyloidogenic features. Amyloid beta A4 precursor protein(APP), encoded by APP gene which locate on human chromosome 21q, is a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. APP expressed in all fetal tissues and is pronounced in brain, kidney, heart and spleen, but weak in liver. Defects in APP are the cause of Alzheimer disease type 1 (AD1). Amyloid β (Aβ) precursor protein (APP) is a 100-140 kDa transmembrane glycoprotein that exists as several isoforms. This antibody can recognize several isoforms of both mature and immature amyloid beta (A4) precursor protein, including APP770, APP677, APP695, APP696, APP733, APP751, APP752, and APP639. APP can be cleaved into several chains, this antibody could recognize fragments C99, Amyloid-beta protein 42, Amyloid-beta protein 40, C83, P3(40), C80, Gamma-secretase C-terminal fragment 59, Gamma-secretase C-terminal fragment 57, Gamma-secretase C-terminal fragment 50, C31. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22408 Product name: Recombinant human APP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 653-751 aa of BC065529 Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN Predict reactive species Full Name: amyloid beta (A4) precursor protein Observed Molecular Weight: 100 kDa GenBank Accession Number: BC065529 Gene Symbol: APP Gene ID (NCBI): 351 RRID: AB_2880118 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05067 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.