Proteintech, 25541-1-AP, SEC14L1 Polyclonal antibody

Size: 20ul / 150ul The SEC14L1 (25541-1-AP) by Proteintech is a Polyclonal antibody targeting SEC14L1 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 25541-1-AP targets SEC14L1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, Y79 cells, HeLa cells Positive IP detected in: HEK-293 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SEC14L1 (SEC14-like protein 1) is a member of SEC14 family in mammals with the potential to control local phospholipid content in membranes. SEC14L1 may act as a phospholipid transfer protein. It has also been reported that SEC14L1 functions as a novel negative regulator of RIG-I-mediated antiviral signaling and is involved in innate immunity (PMID: 17092608; 23843640). SEC14L1 has three isoforms with the molecular mass of 81.2kDa, 81.8kDa and 77.1kDa. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22233 Product name: Recombinant human SEC14L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 149-233 aa of BC142979 Sequence: MKQYTSNIKKGKEIIEYYLRQLEEEGITFVPRWSPPSITPSSETSSSSSKKQAASMAVVIPEAALKEGLSGDALSSPSAPEPVVG Predict reactive species Full Name: SEC14-like 1 (S. cerevisiae) Calculated Molecular Weight: 719 aa, 82 kDa Observed Molecular Weight: 81 kDa, 77 kDa GenBank Accession Number: BC142979 Gene Symbol: SEC14L1 Gene ID (NCBI): 6397 RRID: AB_2880125 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92503 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.