Product Description
Size: 20ul / 150ul
The ZNF689 (25573-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF689 in WB, ELISA applications with reactivity to human, mouse, rat samples
25573-1-AP targets ZNF689 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HeLa cells, HepG2 cells, mouse testis tissue, human testis tissue, mouse tests tissue, rat testis tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Background Information
ZNF689, a C2H2-type of Krüppel-associated box (KRAB)-zinc finger protein, is a putative transcription regulating factor. ZNF689 knockdown induced expression of the pro-apoptotic factors of the Bcl-2 family, Bax, Bcl-2 antagonist/killer 1 and Bid, resulting in tumor cell apoptosis (PMID: 21624362). ZNF689 was identified to be involved in suppressing the apoptosis of HCC cells via downregulation of the expression of pro-apoptotic factors (PMID: 38168642).
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag22252 Product name: Recombinant human ZNF689 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 77-173 aa of BC014000 Sequence: LISWLERNTDDWEPAALDPQEYPRGLTVQRKSRTRKKNGEKEVFPPKEAPRKGKRGRRPSKPRLIPRQTSGGPICPDCGCTFPDHQALESHKCAQNL Predict reactive species
Full Name: zinc finger protein 689
Calculated Molecular Weight: 500 aa, 57 kDa
Observed Molecular Weight: 50-57 kDa
GenBank Accession Number: BC014000
Gene Symbol: ZNF689
Gene ID (NCBI): 115509
RRID: AB_2880134
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96CS4
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924