Proteintech, 25577-1-AP, KBTBD10 Polyclonal antibody

Size: 20ul / 150ul The KBTBD10 (25577-1-AP) by Proteintech is a Polyclonal antibody targeting KBTBD10 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25577-1-AP targets KBTBD10 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue Positive IHC detected in: human heart tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information KBTBD10, also named as KBTBD10 or KRP1, is a 606 amino acid protein, which contains one BACK (BTB/Kelch associated) domain, one BTB (POZ) domain and five Kelch repeats. KBTBD10 localizes in the cytoplasm and is expressed in Sarcomeric muscle. KBTBD10 is involved in skeletal muscle development and differentiation. KBTBD10 regulates proliferation and differentiation of myoblasts and plays a role in myofibril assembly by promoting lateral fusion of adjacent thin fibrils into mature, wide myofibrils. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22311 Product name: Recombinant human KBTBD10 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 205-382 aa of BC006534 Sequence: RTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDDIIKSNPDLQKKIKVLKDAFAGKLPEPSKNAAKTGAGEVNGDVGDEDLLPGYLNDIPRHGMFVKDLILLVNDTAAVAYDPTENECYLTALAEQIPRNHSSIVTQQNQIYVVGGLYVDEENKDQPLQSYFFQLDSIASEWVGLP Predict reactive species Full Name: kelch repeat and BTB (POZ) domain containing 10 Calculated Molecular Weight: 606 aa, 68 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC006534 Gene Symbol: KBTBD10 Gene ID (NCBI): 10324 RRID: AB_2880137 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60662 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.