Iright
BRAND / VENDOR: Proteintech

Proteintech, 25582-1-AP, PABPC5 Polyclonal antibody

CATALOG NUMBER: 25582-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PABPC5 (25582-1-AP) by Proteintech is a Polyclonal antibody targeting PABPC5 in WB, IF/ICC, ELISA applications with reactivity to human samples 25582-1-AP targets PABPC5 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, SKOV-3 cells, U-251 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22216 Product name: Recombinant human PABPC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC063113 Sequence: MGSGEPNPAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRF Predict reactive species Full Name: poly(A) binding protein, cytoplasmic 5 Calculated Molecular Weight: 382 aa, 43 kDa Observed Molecular Weight: 37-43 kDa, 70 kDa GenBank Accession Number: BC063113 Gene Symbol: PABPC5 Gene ID (NCBI): 140886 RRID: AB_3085806 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96DU9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924