Iright
BRAND / VENDOR: Proteintech

Proteintech, 25589-1-AP, SMCHD1 Polyclonal antibody

CATALOG NUMBER: 25589-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SMCHD1 (25589-1-AP) by Proteintech is a Polyclonal antibody targeting SMCHD1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 25589-1-AP targets SMCHD1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Structural maintenance of chromosomes flexible hinge domain containing 1 (SMCHD1) is considered a non-canonical member of the SMC family owing to differences in its type of ATPase domain and in its overall linear domain architecture (PMID: 32779700). SMCHD1 is best known for its role in promoting DNA methylation and gene silencing, with apparent roles in X chromosome inactivation, imprinted gene regulation, and autosome gene cluster repression (PMID: 31668908). Variations in the SMCHD1 gene are associated with two debilitating human disorders, facioscapulohumeral muscular dystrophy (FSHD) and Bosma arhinia microphthalmia syndrome (BAMS) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22293 Product name: Recombinant human SMCHD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1813-2005 aa of BC035774 Sequence: LLTFPDNVEHCETVFGMLLGDTIILDNLDAANHYRKEVVKITHCPTLLTRDGDRIRSNGKFGGLQNKAPPMDKLRGMVFGAPVPKQCLILGEQIDLLQQYRSAVCKLDSVNKDLNSQLEYLRTPDMRKKKQELDEHEKNLKLIEEKLGMTPIRKCNDSLRHSPKVETTDCPVPPKRMRREATRQNRIITKTDV Predict reactive species Full Name: structural maintenance of chromosomes flexible hinge domain containing 1 Calculated Molecular Weight: 2005 aa, 226 kDa Observed Molecular Weight: 220 kDa GenBank Accession Number: BC035774 Gene Symbol: SMCHD1 Gene ID (NCBI): 23347 RRID: AB_2880144 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A6NHR9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924