Product Description
Size: 20ul / 150ul
The SLC10A5 (25597-1-AP) by Proteintech is a Polyclonal antibody targeting SLC10A5 in IHC, ELISA applications with reactivity to human, mouse samples
25597-1-AP targets SLC10A5 in IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
Solute Carrier Family 10 Member 5 (SLC10A5) is a member of SLC10, comprising transporters of bile acids, steroidal hormones, and other substrates. SLC10A5 is involved in the uptake of bile acid, and its deficiency causes hypercholanemia(PMID: 38986003).
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag22339 Product name: Recombinant human SLC10A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-141 aa of BC136625 Sequence: ARMSSLSFLNIEKTEILFFTKTEETILVSSSYENKRPNSSHLFVKIEDPKILQMVNVAKKISSDATNFTINLVTDEEGETNVTIQLWDSEGRQERLIEEIKNVKVKVLKQKDSLLQAPMHIDR Predict reactive species
Full Name: solute carrier family 10 (sodium/bile acid cotransporter family), member 5
Calculated Molecular Weight: 438 aa, 49 kDa
GenBank Accession Number: BC136625
Gene Symbol: SLC10A5
Gene ID (NCBI): 347051
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q5PT55
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924