Proteintech, 25601-1-AP, ZNF251 Polyclonal antibody

Size: 20ul / 150ul The ZNF251 (25601-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF251 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 25601-1-AP targets ZNF251 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue, HepG2 cells, mouse skeletal muscle tissue, SKOV-3 cells Positive IF/ICC detected in: SKOV-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22347 Product name: Recombinant human ZNF251 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-179 aa of BC112137 Sequence: DCGDCGKAFSRRSTLIQHQKVHSGETRKCRKHGPAFVHGSSLTADGQIPTGEKHGRAFNHGANLILRWTVHTGEKSFGCNEYGKAFSPTSRPTEDQIM Predict reactive species Full Name: zinc finger protein 251 Calculated Molecular Weight: 671 aa, 76 kDa Observed Molecular Weight: 70-76 kDa GenBank Accession Number: BC112137 Gene Symbol: ZNF251 Gene ID (NCBI): 90987 RRID: AB_2880154 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRH9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.