Iright
BRAND / VENDOR: Proteintech

Proteintech, 25607-1-AP, TOMM5 Polyclonal antibody

CATALOG NUMBER: 25607-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TOMM5 (25607-1-AP) by Proteintech is a Polyclonal antibody targeting TOMM5 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 25607-1-AP targets TOMM5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue, HepG2 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information TOMM5, also named as C9orf105 and TOM5, has three isoforms with MW 6 kDa and 9-10 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22275 Product name: Recombinant human TOMM5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-51 aa of BC034247 Sequence: MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI Predict reactive species Full Name: translocase of outer mitochondrial membrane 5 homolog (yeast) Calculated Molecular Weight: 51 aa, 6 kDa Observed Molecular Weight: 6-10 kDa GenBank Accession Number: BC034247 Gene Symbol: TOMM5 Gene ID (NCBI): 401505 RRID: AB_2880157 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N4H5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924