Product Description
Size: 20ul / 150ul
The VNN2 (25643-1-AP) by Proteintech is a Polyclonal antibody targeting VNN2 in WB, IF/ICC, ELISA applications with reactivity to human samples
25643-1-AP targets VNN2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HeLa cells
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag22345 Product name: Recombinant human VNN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 448-520 aa of BC126145 Sequence: EIHLSPGKFEVLKDGRLVNKNGSSGPILTVSLFGRWYTKDSLYSSCGTSNSAITYLLIFILLMIIALQNIVML Predict reactive species
Full Name: vanin 2
Calculated Molecular Weight: 520 aa, 59 kDa
Observed Molecular Weight: 33 kDa
GenBank Accession Number: BC126145
Gene Symbol: VNN2
Gene ID (NCBI): 8875
RRID: AB_2880173
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O95498
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924