Iright
BRAND / VENDOR: Proteintech

Proteintech, 25655-1-AP, PAN3 Polyclonal antibody

CATALOG NUMBER: 25655-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PAN3 (25655-1-AP) by Proteintech is a Polyclonal antibody targeting PAN3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25655-1-AP targets PAN3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, NIH/3T3 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Shortening of the poly(A) tail in mRNA, called deadenylation, is the first rate-limiting step in mRNA turnover. PAN3 is the regulatory subunit of a cytoplasmic poly(A) nuclease complex that links the catalytic PAN2 subunit to the poly(A)-binding protein PABP, which stimulates PAN2-dependent deadenylation activity (PMID: 14583602). PAN3 has four isoforms, isoform1: 95 kDa; isoform2: 64 kDa, isoform3: 89 kDa and isoform4: 72 kDa. This antibody recognizes isoform 1/2/3. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22559 Product name: Recombinant human PAN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 512-687 aa of BC128180 Sequence: KAMELVTINYSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLNKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQL Predict reactive species Full Name: PAN3 poly(A) specific ribonuclease subunit homolog (S. cerevisiae) Calculated Molecular Weight: 887 aa, 96 kDa Observed Molecular Weight: 90-100kDa; 65-68 kDa GenBank Accession Number: BC128180 Gene Symbol: PAN3 Gene ID (NCBI): 255967 RRID: AB_3669491 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q58A45 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924