Proteintech, 25703-1-AP, GDPD5 Polyclonal antibody

Size: 20ul / 150ul The GDPD5 (25703-1-AP) by Proteintech is a Polyclonal antibody targeting GDPD5 in WB, IHC, ELISA applications with reactivity to human samples 25703-1-AP targets GDPD5 in WB, IHC, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, COLO 320 cells Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information GDPD5(Glycerophosphodiester phosphodiesterase domain-containing protein 5) is also named as GDE2 and belongs to the glycerophosphoryl diester phosphodiesterase family. The deduced sequence of GDE2 contains 607 amino acids with seven putative transmembrane regions. GDPD5 is a glycerophosphocholine phosphodiesterase that osmotically regulates the osmoprotective organic osmolyte GPC(PMID:18667693). It has 5 isoforms produced by alternative splicing. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22530 Product name: Recombinant human GDPD5 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 474-605 aa of BC018771 Sequence: TSDNSHTLSQVPSPLWIMPPDEYCLMWVTADLVSFTLIVGIFVLQKWRLGGIRSYNPEQIMLSAAVRRTSRDVSIMKEKLIFSEISDGVEVSDVLSVCSDNSYDTYANSTATPVGPRGGGSHTKTLIERSGR Predict reactive species Full Name: glycerophosphodiester phosphodiesterase domain containing 5 Calculated Molecular Weight: 605 aa, 69 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC018771 Gene Symbol: GDPD5 Gene ID (NCBI): 81544 RRID: AB_2880200 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WTR4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.