Product Description
Size: 20ul / 150ul
The ATP1A3 (25727-1-AP) by Proteintech is a Polyclonal antibody targeting ATP1A3 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples
25727-1-AP targets ATP1A3 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue
Positive IP detected in: rat brain tissue
Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: mouse brain tissue
Recommended dilution
Western Blot (WB): WB : 1:2000-1:16000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)-P: IF-P : 1:50-1:500
Background Information
ATP1A3 participates in the catalyticing hydrolysis of ATP and the exchanging of sodium and potassium ions across plasma membrane. The catalyticing activity mode is ATP + H2O + Na+(In) + K+(Out) = ADP + phosphate + Na+(Out) + K+(In). It has been published that the neurologic disorders rapid-onset dystonia-parkionsonism (RDP), alternating hemiplegia of childhood (ACH) and CAPOS syndrome (cerebellar ataxia, areflexia, pes cavus, optic atrophy and sensorineural hearing loss) are all related with the mutation of ATP1A3. There are other reports suggest that early life epilepsy and episodic apnea revealing are potentially associated with the mutation of ATP1A3 as a result of impairment of Na/K homeostasis. This antibody is generated against the C-terminal region (665-1013aa) of ATP1A3 and detects the band around 100-113 kDa in SDS-PAGE.(PMID: 30097153, 20301294, 29922587)
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag22842 Product name: Recombinant human ATP1A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC015566 Sequence: MGDKKDDKDSPKKNKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARD Predict reactive species
Full Name: ATPase, Na+/K+ transporting, alpha 3 polypeptide
Calculated Molecular Weight: 1013 aa, 112 kDa
Observed Molecular Weight: 110-113 kDa
GenBank Accession Number: BC015566
Gene Symbol: ATP1A3
Gene ID (NCBI): 478
RRID: AB_3085820
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P13637
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924