Iright
BRAND / VENDOR: Proteintech

Proteintech, 25731-1-AP, CERK Polyclonal antibody

CATALOG NUMBER: 25731-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CERK (25731-1-AP) by Proteintech is a Polyclonal antibody targeting CERK in WB, IHC, ELISA applications with reactivity to human, mouse samples 25731-1-AP targets CERK in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse liver tissue Positive IHC detected in: mouse heart tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Ceramide kinase (CERK) is a crucial lipid kinase that specifically catalyses ceramide (CER) to ceramide-1-phosphate. It plays a vital role in biological functions and certain diseases, including aberrant wound healing (PMID: 24823941), obesity-diabetes (PMID: 22465662), mesangio-proliferativekidney diseases (PMID: 25134723), cancer (PMID: 25164007) and neuroblastoma (PMID: 22579669). CERK has 2 isoforms with the molecular weight of 60 and 38 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22774 Product name: Recombinant human CERK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 224-537 aa of BC126940 Sequence: AVLVPSSLRIGIIPAGSTDCVCYSTVGTSDAETSALHIVVGDSLAMDVSSVHHNSTLLRYSVSLLGYGFYGDIIKDSEKKRWLGLARYDFSGLKTFLSHHCYEGTVSFLPAQHTVGSPRDRKPCRAGCFVCRQSKQQLEEEQKKALYGLEAAEDVEEWQVVCGKFLAINATNMSCACRRSPRGLSPAAHLGDGSSDLILIRKCSRFNFLRFLIRHTNQQDQFDFTFVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSCCCTVSNSSWNCDGEVLHSPAIEVRVHCQLVRLFARGIEENPKPDSHS Predict reactive species Full Name: ceramide kinase Calculated Molecular Weight: 537 aa, 60 kDa, 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC126940 Gene Symbol: CERK Gene ID (NCBI): 64781 RRID: AB_2880214 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TCT0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924