Iright
BRAND / VENDOR: Proteintech

Proteintech, 25744-1-AP, OATP5A1/SLCO5A1 Polyclonal antibody

CATALOG NUMBER: 25744-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OATP5A1/SLCO5A1 (25744-1-AP) by Proteintech is a Polyclonal antibody targeting OATP5A1/SLCO5A1 in WB, ELISA applications with reactivity to human, mouse, rat samples 25744-1-AP targets OATP5A1/SLCO5A1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: DU 145 cells, mouse brain tissue, PC-3 cells, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22620 Product name: Recombinant human SLCO5A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-128 aa of BC137424 Sequence: MDEGTGLQPGAGEQLEAPATAEAVQERCEPETLRSKSLPVLSSASCRPSLSPTSGDANPAFGCVDSSGHQELKQGPNPLAPSPSAPSTSAGLGDCNHRVDLSKTFSVSSALAMLQERRCLYVVLTDSR Predict reactive species Full Name: solute carrier organic anion transporter family, member 5A1 Observed Molecular Weight: 110-12 kDa GenBank Accession Number: BC137424 Gene Symbol: SLCO5A1 Gene ID (NCBI): 81796 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H2Y9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924