Proteintech, 25750-1-AP, RAPH1 Polyclonal antibody

Size: 20ul / 150ul The RAPH1 (25750-1-AP) by Proteintech is a Polyclonal antibody targeting RAPH1 in WB, IF/ICC, ELISA applications with reactivity to human samples 25750-1-AP targets RAPH1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SKOV-3 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information RAPH1 encodes the lamellipodin protein (Lpd), which binds to Ena and VASPs to assist in actin cytoskeleton assembly; in this way, the gene plays an important role in cellular motility and lamelipodial protrusion. This protein has 9 isoforms producing different molecular weights of 135 kDa, 67 kDa, 70 kDa, 73 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22705 Product name: Recombinant human RAPH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-243 aa of BC156922 Sequence: MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRSPLRQETNMANFSYRFSIYNLNEALNQGETVDLDALMADLCSIEQELSSIGSGNSKRQITETKATQKLPVSRHTLKHGTLKGLSSSSNRIAKPSHASYSLDDVTAQLEQASLSMDEAAQQSVLEDTKPLVTNQHRRTASAGTVSDAEVHSISNSSHSSITSAASSMDSLDIDKVTRPQELDLTHQGQPIT Predict reactive species Full Name: Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 Calculated Molecular Weight: 1250 aa, 135 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC156922 Gene Symbol: RAPH1 Gene ID (NCBI): 65059 RRID: AB_2880223 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q70E73 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.