Iright
BRAND / VENDOR: Proteintech

Proteintech, 25761-1-AP, DEFB121 Polyclonal antibody

CATALOG NUMBER: 25761-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DEFB121 (25761-1-AP) by Proteintech is a Polyclonal antibody targeting DEFB121 in IHC, ELISA applications with reactivity to human samples 25761-1-AP targets DEFB121 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human small intestine tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22712 Product name: Recombinant human DEFB121 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 17-76 aa of BC130609 Sequence: VTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVKPKLTDTNTSLESTSAV Predict reactive species Full Name: defensin, beta 121 Calculated Molecular Weight: 76 aa, 8 kDa GenBank Accession Number: BC130609 Gene Symbol: DEFB121 Gene ID (NCBI): 245934 RRID: AB_2880228 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5J5C9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924