Proteintech, 25767-1-AP, C1orf113 Polyclonal antibody

Size: 20ul / 150ul The C1orf113 (25767-1-AP) by Proteintech is a Polyclonal antibody targeting C1orf113 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 25767-1-AP targets C1orf113 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22643 Product name: Recombinant human C1orf113 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-342 aa of BC101676 Sequence: MPDKTATPERPPAPENAPSSKKIPAPDKVPSPEKTLTLGDKASIPGNSTSGKIPAPDKVPTPEKMVTPEDKASIPENSIIPEETLTVDKPSTPERVFSVEESPALEAPPMDKVPNPKMAPLGDEAPTLEKVLTPELSEEEVSTRDDIQFHHFSSEEALQKVKYFVAKEDPSSQEEAHTPEAPPPQPPSSERCLGEMKCTLVRGDSSPRQAELKSGPASRPALEKPHPHEEATTLPEEAPSNDERTPEEEAPPNEQRPLREEVLPKEGVASKEEVTLKEELPPKEEVAPKEEVPPIERAFAQKTRPIKPPPDSQETLALPSLVPQNYTENKNEGVDVTSLRGE Predict reactive species Full Name: chromosome 1 open reading frame 113 Calculated Molecular Weight: 640 aa, 71 kDa Observed Molecular Weight: 70-71 kDa GenBank Accession Number: BC101676 Gene Symbol: C1orf113 Gene ID (NCBI): 79729 RRID: AB_2880232 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A4FU49 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.