Proteintech, 25768-1-AP, USP19 Polyclonal antibody

Size: 20ul / 150ul The USP19 (25768-1-AP) by Proteintech is a Polyclonal antibody targeting USP19 in WB, IP, ELISA applications with reactivity to human samples 25768-1-AP targets USP19 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, Jurkat cells, MDA-MB-231 cells Positive IP detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Ubiquitin-specific protease (USP)19 is a recently identified deubiquitinating enzyme (DUB) having multiple splice variants and cellular functions. Since the sum of molecular weights of the two small bands (65 kDa+120 kDa) approximates the size of the full-length protein (~185 kDa), USP19 is likely to be endoproteolytically cleaved. Interestingly, the small bands were not observed when the DUB activity was inactivated, suggesting that the cleavage of USP19 depends on its DUB activity (PMID: 25088257). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22646 Product name: Recombinant human USP19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 203-500 aa of BC146752 Sequence: VEADEQLCIPPLNSQTCLLGSEENLAPLAGEKAVPPGNDPVSPAMVRSRNPGKDDCAKEEMAVAADAATLVDEPESMVNLAFVKNDSYEKGPDSVVVHVYVKEICRDTSRVLFREQDFTLIFQTRDGNFLRLHPGCGPHTTFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQSQRWGGLEAPAARVGGAKVAVPTGPTPLDSTPPGGAPHPLTGQEEARAVEKDKSKARSEDTGLDSVATRTPMEHVTPKPETHLASPKPTCMVPPMPHSPVSGDSVEEEEEEEKKVCLPGFTGLV Predict reactive species Full Name: ubiquitin specific peptidase 19 Calculated Molecular Weight: 1318 aa, 146 kDa Observed Molecular Weight: 70 kDa, 120 kDa, 150-180 kDa GenBank Accession Number: BC146752 Gene Symbol: USP19 Gene ID (NCBI): 10869 RRID: AB_2713918 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94966 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.