Iright
BRAND / VENDOR: Proteintech

Proteintech, 25772-1-AP, MYO1G Polyclonal antibody

CATALOG NUMBER: 25772-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MYO1G (25772-1-AP) by Proteintech is a Polyclonal antibody targeting MYO1G in WB, IF/ICC, ELISA applications with reactivity to human samples 25772-1-AP targets MYO1G in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, Raji cells Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MYO1G is a plasma membrane-associated class I myosin that is abundant in T and B lymphocytes and mast cells and expressed specifically in the haematopoietic system. Class I myosins have been implicated in various cellular processes relying on actin-dependent membrane dynamics such as endocytosis, secretion, adhesion, motility and regulation of mechanosensitive channels (PMID: 19968988). MYO1G localizes to the plasma membrane linked to PIP2 and PIP3, is particularly enriched at cell-surface microvilli, and associates in an ATP-releasable manner to the actin cytoskeleton (PMID: 24310084). MYO1G can be detected as about 110-120 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22696 Product name: Recombinant human MYO1G protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 190-391 aa of BC113544 Sequence: RVLKQHVGERNFHAFYQLLRGSEDKQLHELHLERNPAVYNFTHQGAGLNMTVHSALDSDEQSHQAVTEAMRVIGFSPEEVESVHRILAAILHLGNIEFVETEEGGLQKEGLAVAEEALVDHVAELTATPRDLVLRSLLARTVASGGRELIEKGHTAAEASYARDACAKAVYQRLFEWVVNRINSVMEPRGRDPRRDGKDTVI Predict reactive species Full Name: myosin IG Calculated Molecular Weight: 1018 aa, 116 kDa Observed Molecular Weight: 110-120 kDa GenBank Accession Number: BC113544 Gene Symbol: MYO1G Gene ID (NCBI): 64005 RRID: AB_3085822 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: B0I1T2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924