Proteintech, 25799-1-AP, PLA2G12B Polyclonal antibody

Size: 20ul / 150ul The PLA2G12B (25799-1-AP) by Proteintech is a Polyclonal antibody targeting PLA2G12B in WB, ELISA applications with reactivity to human, mouse, rat samples 25799-1-AP targets PLA2G12B in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, HepG2 cells, HuH-7 cells, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Phospholipase A2 (PLA2) enzymes catalyze hydrolysis of glycolipids to release free fatty acids and lysophospholipids. PLA2G12B is a secreted group XIIB secretory phospholipase A2-like protein belonging to the PLA2 family, but it is catalytically inactive due to an amino acid change in its active site and has altered phospholipid-binding properties (PMID: 14516201). It is located outside the cell membranes and strongly expressed in liver, small intestine and kidney, and recently reports revealed that Pla2g12b gene may be implicated in HDL cholesterol levels and metabolism (PMID: 22912808). The calculated molecular weight of PLA2G12B is 21 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22877 Product name: Recombinant human PLA2G12B protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 115-195 aa of BC111946 Sequence: LDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSKVEAACDSLVDTVFNTVWTLGCRPFMNSQRAACICAEEEKEEL Predict reactive species Full Name: phospholipase A2, group XIIB Calculated Molecular Weight: 195 aa, 22 kDa Observed Molecular Weight: 21-22 kDa GenBank Accession Number: BC111946 Gene Symbol: PLA2G12B Gene ID (NCBI): 84647 RRID: AB_3085823 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BX93 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.