Iright
BRAND / VENDOR: Proteintech

Proteintech, 25817-1-AP, ZNF639 Polyclonal antibody

CATALOG NUMBER: 25817-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF639 (25817-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF639 in WB, IHC, IP, ELISA applications with reactivity to human samples 25817-1-AP targets ZNF639 in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information ZNF639, also named as ZASC1, is a 485 amino acid protein, which locates in the nucleus and contains 8 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZNF639 binds DNA and may function as a transcriptional repressor. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19854 Product name: Recombinant human ZNF639 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 136-485 aa of BC026181 Sequence: EDVPIAVEVHAISEDYDIETENNSSESLQDQTDEEPPAKLCKILDKSQALNVTAQQKWPLLRANSSGLYKCELCEFNSKYFSDLKQHMILKHKRTDSNVCRVCKESFSTNMLLIEHAKLHEEDPYICKYCDYKTVIFENLSQHIADTHFSDHLYWCEQCDVQFSSSSELYLHFQEHSCDEQYLCQFCEHETNDPEDLHSHVVNEHACKLIELSDKYNNGEHGQYSLLSKITFDKCKNFFVCQVCGFRSRLHTNVNRHVAIEHTKIFPHVCDDCGKGFSSMLEYCKHLNSHLSEGIYLCQYCEYSTGQIEDLKIHLDFKHSADLPHKCSDCLMRFGNERELISHLPVHETT Predict reactive species Full Name: zinc finger protein 639 Calculated Molecular Weight: 485 aa, 56 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC026181 Gene Symbol: ZNF639 Gene ID (NCBI): 51193 RRID: AB_2880251 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UID6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924