Product Description
Size: 20ul / 150ul
The STK25 (25821-1-AP) by Proteintech is a Polyclonal antibody targeting STK25 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples
25821-1-AP targets STK25 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: Neuro-2a cells, HepG2 cells, mouse brain tissue, rat brain tissue
Positive IP detected in: mouse brain tissue
Recommended dilution
Western Blot (WB): WB : 1:2000-1:10000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag22964 Product name: Recombinant human STK25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 323-426 aa of BC015793 Sequence: PTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHEQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR Predict reactive species
Full Name: serine/threonine kinase 25 (STE20 homolog, yeast)
Calculated Molecular Weight: 48 kDa
Observed Molecular Weight: 48 kDa
GenBank Accession Number: BC015793
Gene Symbol: STK25
Gene ID (NCBI): 10494
RRID: AB_2880255
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O00506
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924