Iright
BRAND / VENDOR: Proteintech

Proteintech, 25822-1-AP, CCDC33 Polyclonal antibody

CATALOG NUMBER: 25822-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCDC33 (25822-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC33 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 25822-1-AP targets CCDC33 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat testis tissue Positive IP detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information The human CCDC33 gene was reported to encode a cancer/testis (CT) antigen, which is located on 15q24.1, spans a region of 99.8 kb, and consists of 20 exons (PMID: 28639886). CCDC33 is predominantly expressed in the testis and undergoes alternative splicing to produce at least 5 different transcripts (37kda, 41kda, 85kda, 107kda, 114kda). Human CCDC33 was reported to be a cancer/testis (CT) protein. Abundant expression of Ccdc33 is evident during mouse spermatogenesis (PMID: 33942254). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22893 Product name: Recombinant human CCDC33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-206 aa of BC025689 Sequence: SEMNNYRRAMQKMAEDILSLRRQASILEGENRILRSRLAQQEEEEGQGKASEAQNTVSMKQKLLLSELDMKKLRDRVQHLQNELIRKNDREKELLLLYQAQQPQAALLKQYQGKLQKMKALEETVRHQEKVIEKMERVLEDRLQDRSKPPPLNRQQGKPYTGFPMLSASGLPLGSMGENLPVELYSVLLAENAKLRTELDKNRHQQ Predict reactive species Full Name: coiled-coil domain containing 33 Calculated Molecular Weight: 958 aa, 107 kDa Observed Molecular Weight: 85 kDa GenBank Accession Number: BC025689 Gene Symbol: CCDC33 Gene ID (NCBI): 80125 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N5R6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924