Iright
BRAND / VENDOR: Proteintech

Proteintech, 25829-1-AP, TFAP2E Polyclonal antibody

CATALOG NUMBER: 25829-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TFAP2E (25829-1-AP) by Proteintech is a Polyclonal antibody targeting TFAP2E in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 25829-1-AP targets TFAP2E in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, mouse brain tissue, rat brain tissue Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A375 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23023 Product name: Recombinant human TFAP2E protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 58-219 aa of BC041175 Sequence: YGQAPDAAAAFPHLAGDPYGGLAPLAQPQPPQAAWAAPRAAARAHEEPPGLLAPPARALGLDPRRDYATAVPRLLHGLADGAHGLADAPLGLPGLAAAPGLEDLQAMDEPGMSLLDQSVIKKVPIPSKASSLSALSLAKDSLVGGITNPGEVFCSVPGRLSL Predict reactive species Full Name: transcription factor AP-2 epsilon (activating enhancer binding protein 2 epsilon) Calculated Molecular Weight: 442 aa, 46 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC041175 Gene Symbol: TFAP2E Gene ID (NCBI): 339488 RRID: AB_2880258 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6VUC0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924