Proteintech, 25855-1-AP, DECR2 Polyclonal antibody

Size: 20ul / 150ul The DECR2 (25855-1-AP) by Proteintech is a Polyclonal antibody targeting DECR2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25855-1-AP targets DECR2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse lung tissue Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23052 Product name: Recombinant human DECR2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-244 aa of BC011968 Sequence: MRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPNGVKGLPDFASFSAKL Predict reactive species Full Name: 2,4-dienoyl CoA reductase 2, peroxisomal Calculated Molecular Weight: 292 aa, 31 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC011968 Gene Symbol: DECR2 Gene ID (NCBI): 26063 RRID: AB_2880270 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NUI1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.