Iright
BRAND / VENDOR: Proteintech

Proteintech, 25857-1-AP, SAC3D1 Polyclonal antibody

CATALOG NUMBER: 25857-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SAC3D1 (25857-1-AP) by Proteintech is a Polyclonal antibody targeting SAC3D1 in WB, IHC, ELISA applications with reactivity to human samples 25857-1-AP targets SAC3D1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, HeLa cells, PC-3 cells, HeLa cells Positive IHC detected in: human liver cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SAC3D1, also named as SHD1 and HSU79266. SAC3D1 is widely found in the cytoplasm, cytoskeleton, microtubule, tissue center, centrosome and spindle, involved in centrosome duplication and mitotic progression. SAC3D1 is abnormally expressed in multiple types of cancer, such as colon cancer and hepatocellular carcinoma and gastric cancer. SAC3D1 may serve as a prognostic biomarker in hepatocellular carcinoma (PMID: 30353105, 32319600). SAC3D1 has 2 isoforms with the molecular mass of 44 and 31 kDa. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23026 Product name: Recombinant human SAC3D1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 97-404 aa of BC007448 Sequence: VKEYSRPAAGKPRPPPSQLRPPSVLLATVRYLAGEVAESADIARAEVASFVADRLRAVRLDLALQGAGDAEAAVVLEAALATLLAVVARLGPDAARGPADPVLLQAQVQEGFGSLRRCYARGAGPHPRQPAFQGLFLLYNLGSVEALHEVLQLPAALRACPPLRKALAVDAAFREGNAARLFRLLQTLPYLPSCAVQCHVGHARREALARFARAFSTPKGQTLPLGFMVNLLALDGLREARDLCQAHGLPLDGEERVVFLRGRYVEEGLPPASTCKVLVESKLRGRTLEEVVMAEEEDEGTDRPGSPA Predict reactive species Full Name: SAC3 domain containing 1 Calculated Molecular Weight: 404 aa, 44 kDa Observed Molecular Weight: 44, 31 kDa GenBank Accession Number: BC007448 Gene Symbol: SAC3D1 Gene ID (NCBI): 29901 RRID: AB_2918096 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: F8WC89 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924