Proteintech, 25865-1-AP, PIM2 Polyclonal antibody

Size: 20ul / 150ul The PIM2 (25865-1-AP) by Proteintech is a Polyclonal antibody targeting PIM2 in IP, IHC, ELISA applications with reactivity to human, mouse samples 25865-1-AP targets PIM2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: Raji cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PIM2 was first identified in T and B cell lymphomas in mice and is a member of a serine/threonine kinase family of proto-oncogenes, which also includes PIM1 and PIM3 (PMID:24505470). They share high sequence homology at the amino acid level; PIM1 and PIM2 are 61% identical and PIM1 and PIM3 are 71% identical (PMID:34503111). The PIM2 protein plays an important role in promoting cell survival and preventing apoptosis. PIM2 is mainly expressed in lymphoid and brain tissues. In human cells, the PIM2 kinase has only two isoforms (34 and 41 kDa), but in mice there are there (34, 37, and 40 kDa), and the 34 kDa isoform has been the main focus of many studies because it plays a crucial role in tumor progression (PMID:33854618). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23130 Product name: Recombinant human PIM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 240-311 aa of BC018111 Sequence: RDQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKGGPAPLAWSLLP Predict reactive species Full Name: pim-2 oncogene Calculated Molecular Weight: 311 aa, 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC018111 Gene Symbol: PIM2 Gene ID (NCBI): 11040 RRID: AB_2880275 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P1W9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.