Proteintech, 25948-1-AP, GlyT2 Polyclonal antibody

Size: 20ul / 150ul The GlyT2 (25948-1-AP) by Proteintech is a Polyclonal antibody targeting GlyT2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 25948-1-AP targets GlyT2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information GlyT2 is a transporter protein of the SLC6 family of sodium- and chloride-dependent neurotransmitter transporters. Like other members of the family, GlyT2 is trafficked to the cell surface as homo-oligomers from the endoplasmic reticulum (ER) (PMID: 32714574). GlyT2 is expressed in medulla, and to a lesser extent in spinal cord and cerebellum. GlyT2 has 3 isoforms with the molecular mass of 63, 86 and 87 kDa. The 63 kDa band is the unglycosylated GlyT2 polypeptide, whereas the 70-110 kDa band is a differential glycosylation form of GlyT2 (PMID: 17851090, 17962467). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22835 Product name: Recombinant human SLC6A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC096319 Sequence: MDCSAPKEMNKLPANSPEAAAAQGHPDGPCAPRTSPEQELPAAAAPPPPRVPRSASTGAQTFQSADARACEAERPGVGSCKLSSPRAQAASAALRDLREAQGAQASPPPGSSGPGNALHCKIPSLRGPEGDANVSVGKGTLERNNTPVVGWVNMSQSTVVLGTDGITSVLPGSVATVATQEDEQGDENKARGNWSSKLDF Predict reactive species Full Name: solute carrier family 6 (neurotransmitter transporter, glycine), member 5 Calculated Molecular Weight: 797 aa, 87 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC096319 Gene Symbol: GlyT2 Gene ID (NCBI): 9152 RRID: AB_3085831 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y345 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.