Proteintech, 26001-1-AP, SRD5A1 Polyclonal antibody

Size: 20ul / 150ul The SRD5A1 (26001-1-AP) by Proteintech is a Polyclonal antibody targeting SRD5A1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26001-1-AP targets SRD5A1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue, DU 145 cells Positive IHC detected in: human colon cancer tissue, human prostate cancer tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Steroid 5-alpha-reductase (SRD5A1) catalyzes the conversion of 17β-Hydroxyandrost-4-en-3-one into the more potent androgen, DHT. SRD5A1 is a minor component of the reductase activity in prostate although the gene was originally cloned from prostate. On the other hand, SRD5A1 appears to be the predominant isozyme of steroid 5-alpha-reductase in the scalp and elsewhere in the skin. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23351 Product name: Recombinant human SRD5A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-163 aa of BC007033 Sequence: MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGML Predict reactive species Full Name: steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) Observed Molecular Weight: 29 kDa GenBank Accession Number: BC007033 Gene Symbol: SRD5A1 Gene ID (NCBI): 6715 RRID: AB_2880328 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P18405 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.