Iright
BRAND / VENDOR: Proteintech

Proteintech, 26021-1-AP, LRRC32 Polyclonal antibody

CATALOG NUMBER: 26021-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LRRC32 (26021-1-AP) by Proteintech is a Polyclonal antibody targeting LRRC32 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26021-1-AP targets LRRC32 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HUVEC cells Positive IHC detected in: human tonsillitis tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information LRRC32, also known as GARP, is a transmembrane protein of 662 amino acids, the extracellular portion of which contains 20 leucine-rich repeats (PMID: 8180135). LRRC32 is a cell surface receptor on regulatory T-lymphocytes (Treg cells), platelets, hepatic stellate cells and certain cancer cells (PMID: 27054568). It has been demonstrated as a Treg-specific activation marker (PMID: 20137067). LRRC32 is critical for the surface expression of latent TGF-β by binding to the complex and functioning as its cell surface receptor (PMID: 19651619). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23423 Product name: Recombinant human LRRC32 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 477-662 aa of BC070079 Sequence: PGLEVATGALGGLEASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEKGGLKNINLIIILTFILVSAILLTTLAACCCVRRQKFNQQYKA Predict reactive species Full Name: leucine rich repeat containing 32 Calculated Molecular Weight: 72 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC070079 Gene Symbol: LRRC32 Gene ID (NCBI): 2615 RRID: AB_2880339 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14392 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924